PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005963-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRAS
Protein Properties Length: 527aa    MW: 58587.1 Da    PI: 4.9657
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005963-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS425.15.6e-1301595273374
                   GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            +lL+ecA a+++g+ ++a++++  l++++s +g+p  R+aay++eAL ar+a s+ +lykal++++ +   ss++l+a+++++e++P+
  SMil_00005963-RA_Salv 159 SLLFECAAAIQNGNCHEASQMIDVLRQRVSIQGEPSDRIAAYMVEALVARMATSGRGLYKALKCKSPP---SSDRLSAMQVLFEACPC 243
                            79*****************************************************************9...9**************** PP

                   GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                            ++f++++aN aIle    eervHiiDfdi+qG Q+ +Ll++La+ +++ p++R+Tgv++pes+      l+ +gerL+++A+ l+++f
  SMil_00005963-RA_Salv 244 FRFGFMAANGAILETCRDEERVHIIDFDINQGSQYYTLLKTLAETRGQRPHVRLTGVDDPESVqrGVGGLNIIGERLEQLAKDLQLSF 331
                            *************************************************************99888899******************* PP

                   GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                            ef++ va +++ ++++ L +++gEal+Vn+++qlh+l+desvs+++ rd++L++vksl+Pk+v++veq++++n+++Fl rf+ea +yy
  SMil_00005963-RA_Salv 332 EFHA-VAAETALVSPSLLGCRQGEALVVNFAFQLHHLPDESVSTTNLRDQLLRMVKSLKPKLVTLVEQDVNTNTSPFLLRFAEAYNYY 418
                            ****.7999******************************************************************************* PP

                   GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                            sa+f sl+a+l+r++++ri+vE+++l+r+i nvvaceg+er+er e ++kW++r+++aGF+p p+s +++ +++ l+r+++++ y+v+
  SMil_00005963-RA_Salv 419 SAVFASLDATLGRNNQDRINVEKHCLARDIINVVACEGEERIERYEVAGKWKARMSMAGFNPRPISGNVYVEIQKLIRQYSDR-YKVK 505
                            *********************************************************************************66.**** PP

                   GRAS 353 eesgslvlgWkdrpLvsvSaWr 374
                            ee g+l +gW+d+ L+  SaWr
  SMil_00005963-RA_Salv 506 EETGTLHFGWEDKMLILSSAWR 527
                            *********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.153131508IPR005202Transcription factor GRAS
PfamPF035142.0E-127159527IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MPLVTSAANL GSHERYTVKD GDNTSETSIS MFGSDATCTS QSSSGDSYGQ KYLLDSPLVT  60
SRQDIGEFDY ELDGQSLDMA GYDSDKMKLK LQELEKVLLD DNAANDDCQN MEIEGGLSDT  120
TCYALIHDSP KESSSSNSIR SIISTTRELS FTTTPTPKSL LFECAAAIQN GNCHEASQMI  180
DVLRQRVSIQ GEPSDRIAAY MVEALVARMA TSGRGLYKAL KCKSPPSSDR LSAMQVLFEA  240
CPCFRFGFMA ANGAILETCR DEERVHIIDF DINQGSQYYT LLKTLAETRG QRPHVRLTGV  300
DDPESVQRGV GGLNIIGERL EQLAKDLQLS FEFHAVAAET ALVSPSLLGC RQGEALVVNF  360
AFQLHHLPDE SVSTTNLRDQ LLRMVKSLKP KLVTLVEQDV NTNTSPFLLR FAEAYNYYSA  420
VFASLDATLG RNNQDRINVE KHCLARDIIN VVACEGEERI ERYEVAGKWK ARMSMAGFNP  480
RPISGNVYVE IQKLIRQYSD RYKVKEETGT LHFGWEDKML ILSSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-531535271375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A068UU850.0A0A068UU85_COFCA; Uncharacterized protein
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1